PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00146115001
Common NameGSBRNA2T00146115001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 251aa    MW: 27201.8 Da    PI: 7.2023
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00146115001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.23.7e-382888262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++++lkcprC+s ntkfCyynny+ sqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  GSBRNA2T00146115001 28 HHQSLKCPRCNSLNTKFCYYNNYNHSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRSK 88
                         57899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-321982IPR003851Zinc finger, Dof-type
PfamPF027011.1E-323086IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1993286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MQDIHDYSMT GEGGDRRMRV HQNNILNHHQ SLKCPRCNSL NTKFCYYNNY NHSQPRHFCK  60
NCRRYWTKGG VLRNVPVGGG CRKAKRSKSK QPPSSSSTST ADKPTAQDGE EKPSSSESSS  120
LPASTSTATA ATAAAAKGVM GADMHNLKLY GNGIEWSTLL GQGSSDGGVF SEMGGFTAAS  180
SIATTPFGFG GNTVQQQFED RTAQVDPTME FEPLDWGSSG ADQTLFDLTS TADNAYWSHQ  240
DQTDLYLPQF *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.267881e-54leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00146115001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531381e-106AK353138.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-G03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609466.10.0PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR01e-114DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A078DFK00.0A0A078DFK0_BRANA; BnaC09g05040D protein
TrEMBLA0A0D3E1N30.0A0A0D3E1N3_BRAOL; Uncharacterized protein
STRINGBra035956.1-P1e-141(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-96OBF binding protein 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]